elearning-cdn - /swf/


[To Parent Directory]

1/6/2010 1:29 PM 19198749 AdviseRecommendSuggest-Common Mistakes in English.flv
1/13/2010 2:28 AM 19198749 AdviseRecommendSuggest-Common Mistakes in EnglishYouTube- Lesson 1-AdviseRecommendSuggest-Common Mistakes in English.flv
1/4/2011 12:18 PM 1106763 agama_manasik_haji.swf
12/3/2010 6:24 AM 9493536 Algebra - Quadratic Equation.flv
12/3/2010 7:08 AM 9116117 Applying Quadratic Functions 1.flv
12/3/2010 7:12 AM 20768914 Applying Quadratic Functions 2.flv
6/15/2010 12:44 PM 278638 arithmetic.swf
1/10/2011 8:51 AM 418494 bahasa_ind_alur_penokohan_dalam_cerpen.swf
1/10/2011 9:05 AM 422091 bahasa_ind_berpidato_tanpa_text.swf
1/10/2011 8:33 AM 1535059 bahasa_ind_kegiatan_berbahasa.swf
1/10/2011 8:31 AM 1470851 bahasa_ind_ketrampilan_berbahasa.swf
1/10/2011 8:25 AM 1697178 bahasa_ind_memahami_bacaan.swf
1/10/2011 9:12 AM 383560 bahasa_ind_memahami_isi_laporan.swf
1/10/2011 8:32 AM 1687670 bahasa_ind_memahami_sastra.swf
1/10/2011 8:33 AM 1317083 bahasa_ind_memahami_unsur_pokok_bacaan.swf
1/10/2011 8:49 AM 443866 bahasa_ind_membaca_cepat.swf
1/10/2011 8:46 AM 422094 bahasa_ind_membaca_dan_mengalisa_hukayat.swf
1/10/2011 8:45 AM 368504 bahasa_ind_membaca_intensif.swf
1/10/2011 8:50 AM 394701 bahasa_ind_membaca_intensif_2.swf
1/10/2011 8:40 AM 1449508 bahasa_ind_membaca_naskah.swf
1/10/2011 8:57 AM 335922 bahasa_ind_membedakan_fakta_dengan_opini.swf
1/10/2011 8:37 AM 1253299 bahasa_ind_menanggapi_hasil_seminar.swf
1/10/2011 9:04 AM 531637 bahasa_ind_mendengarkan_berita.swf
1/10/2011 9:00 AM 369326 bahasa_ind_menemukan_ide_pokok.swf
1/10/2011 9:00 AM 319517 bahasa_ind_mengajukan_saran_lisan.swf
1/10/2011 9:01 AM 377463 bahasa_ind_mengajukan_saran_perbaikan.swf
1/10/2011 8:59 AM 369808 bahasa_ind_mengkritisi_laporan_lisan.swf
1/10/2011 8:47 AM 459396 bahasa_ind_menjelaskan_isi_artikel.swf
1/10/2011 8:50 AM 315683 bahasa_ind_menulis_karya_ilmiah.swf
1/10/2011 8:52 AM 500095 bahasa_ind_menulis_naskah_drama.swf
1/10/2011 8:58 AM 384773 bahasa_ind_menulis_surat_lamaran_pekerjaan.swf
1/10/2011 8:56 AM 357956 bahasa_ind_menyampaikan_gagasan.swf
1/10/2011 9:10 AM 553623 bahasa_ind_menyampaikan_intisari_biografi.swf
1/10/2011 8:48 AM 558002 bahasa_ind_pementasan_drama.swf
1/10/2011 8:30 AM 1602649 bahasa_ind_tindakan_berbahas.swf
1/8/2011 10:26 AM 745616 Bahasa_indonesia_berbahasa_bersastra.swf
1/8/2011 10:16 AM 535335 bahasa_indonesia_indentifikasi_unsur_cerita.swf
1/8/2011 10:24 AM 544091 Bahasa_indonesia_Kesusatraan.swf
1/8/2011 10:30 AM 721712 Bahasa_indonesia_mejaring_informasi_media.swf
1/8/2011 10:31 AM 658372 Bahasa_indonesia_mejaring_informasi_peristiwa.swf
1/8/2011 10:13 AM 485618 bahasa_indonesia_mendengar_mengungkapkan_puisi.swf
1/8/2011 9:58 AM 523101 bahasa_indonesia_menjaring_informasi.swf
1/8/2011 10:19 AM 468225 bahasa_indonesia_menjaring_informasi_ekonomi.swf
1/8/2011 10:07 AM 682440 bahasa_indonesia_menjaring_informasi_peristiwa.swf
1/8/2011 10:18 AM 527746 bahasa_indonesia_menjaring_informasi_surat_kabar.swf
1/10/2011 2:27 PM 682566 bahasa_ing_accepting_invitation.swf
1/10/2011 4:48 PM 884136 bahasa_ing_accusing_and_admiting.swf
1/10/2011 2:41 PM 428742 bahasa_ing_advising_and_warning.swf
1/10/2011 2:23 PM 842133 bahasa_ing_appointment.swf
1/10/2011 2:40 PM 500630 bahasa_ing_Asking_for_opnion.swf
1/10/2011 4:49 PM 628606 bahasa_ing_asking_persuading_regreting.swf
1/10/2011 4:52 PM 804700 bahasa_ing_assessing_criticizing.swf
1/10/2011 4:45 PM 852646 bahasa_ing_complaining_blaming.swf
1/10/2011 2:24 PM 865957 bahasa_ing_complementing_someone.swf
1/10/2011 3:01 PM 407441 bahasa_ing_drama.swf
1/10/2011 2:45 PM 437346 bahasa_ing_Excited.swf
1/10/2011 2:25 PM 765454 bahasa_ing_exiting.swf
1/10/2011 3:00 PM 362719 bahasa_ing_expressing_anger.swf
1/10/2011 2:58 PM 353649 bahasa_ing_expressing_annoyance.swf
1/10/2011 2:39 PM 475307 bahasa_ing_expressing_disatisfaction.swf
1/10/2011 2:25 PM 540802 bahasa_ing_expressing_disbelief_surprice.swf
1/10/2011 2:55 PM 437346 bahasa_ing_expressing_disbelief_surprise.swf
1/10/2011 2:59 PM 385977 bahasa_ing_expressing_embrassment.swf
1/10/2011 4:50 PM 682895 bahasa_ing_expressing_hoping_intention.swf
1/10/2011 2:42 PM 475556 bahasa_ing_expressing_pleasure_plan.swf
1/10/2011 2:57 PM 403878 bahasa_ing_expressing_stance.swf
1/10/2011 4:47 PM 642431 bahasa_ing_expressing_stance_2.swf
1/10/2011 4:46 PM 628359 bahasa_ing_expression_curiousity_discussing.swf
1/10/2011 2:37 PM 496349 bahasa_ing_granting_request.swf
1/10/2011 1:58 PM 710161 bahasa_ing_introduce.swf
1/10/2011 2:20 PM 972122 bahasa_ing_invitation.swf
1/10/2011 3:04 PM 374184 bahasa_ing_movie_script.swf
1/10/2011 2:22 PM 681601 bahasa_ing_pleased.swf
1/10/2011 3:05 PM 482419 bahasa_ing_poetry.swf
1/10/2011 4:46 PM 773352 bahasa_ing_proposing.swf
1/10/2011 3:20 PM 517240 bahasa_ing_responding_to_advice.swf
1/10/2011 3:20 PM 517271 bahasa_ing_responding_to_someone.swf
1/10/2011 2:23 PM 608876 bahasa_ing_responding_to_thanks.swf
1/10/2011 2:00 PM 859445 bahasa_ing_showing_attention.swf
1/10/2011 2:44 PM 470405 bahasa_ing_Stage in presenting.swf
1/10/2011 2:43 PM 388068 bahasa_ing_Stages_in_reading_reporting_interviewing.swf
1/10/2011 2:12 PM 681601 bahasa_ing_thanking.swf
5/16/2006 8:22 PM 453915 bahasa_inggris_reading_writing_1.swf
5/16/2006 8:13 PM 71945 bahasa_inggris_reading_writing_2.swf
5/16/2006 8:18 PM 102635 bahasa_inggris_reading_writing_3.swf
5/16/2006 8:10 PM 152233 bahasa_inggris_reading_writing_4.swf
5/16/2006 8:07 PM 527986 bahasa_inggris_reading_writing_5.swf
1/21/2007 9:47 PM 80229 bahasa_inggris_uji_kompetensi.swf
1/7/2011 3:40 PM 61778650 bahasaindonesia_sma1_bersatukitateguhberceraikitaruntuh.flv
1/7/2011 3:42 PM 53716407 bahasaindonesia_sma1_kalimatperintah.flv
1/7/2011 3:44 PM 63645441 bahasaindonesia_sma1_kataberantonim.flv
1/7/2011 3:47 PM 73177594 bahasaindonesia_sma1_kataberawalanme&ber.flv
1/7/2011 3:50 PM 76234568 bahasaindonesia_sma1_katabersinonim.flv
1/7/2011 3:53 PM 58615349 bahasaindonesia_sma1_sejutamakna.flv
1/6/2011 3:44 PM 81056735 bahasaindonesia_sma2_awalanDidanKe.flv
1/6/2011 3:46 PM 51196481 bahasaindonesia_sma2_katagantipenghubungyangdalamkalimat.flv
1/6/2011 3:49 PM 79630757 bahasaindonesia_sma2_menafsirkanisiwacanapuisi.flv
1/7/2011 4:46 PM 67283856 bahasaindonesia_sma3_dimensiaspekdannaskahdrama.flv
1/7/2011 4:39 PM 65146808 bahasaindonesia_sma3_kataulangkatakerja.flv
1/7/2011 4:41 PM 62161140 bahasaindonesia_sma3_menjaringinformasi.flv
1/7/2011 4:44 PM 79721164 bahasaindonesia_sma3_pokokdantokoh.flv
1/7/2011 5:34 PM 38193666 bahasaindonesia_sma3_tertibdijalancerminkepribadianbangsa.flv
1/21/2007 9:47 PM 212105 biologi_asma.swf
6/9/2006 3:55 PM 828839 biologi_basiodiamycota.swf
1/10/2011 5:05 PM 483364 biologi_bioteknologi.swf
6/9/2006 4:15 PM 396747 biologi_demam_berdarah.swf
5/16/2006 7:07 PM 131893 Biologi_dna.swf
1/10/2011 4:59 PM 296956 biologi_dna_gen_kromosom.swf
1/10/2011 4:58 PM 277321 biologi_enzim.swf
1/10/2011 5:02 PM 5405869 biologi_evolusi.swf
1/10/2011 4:57 PM 319721 biologi_faktor_pertumbuhan_perkembangan_tumbuhan.swf
5/16/2006 7:21 PM 199761 biologi_fertilisasi.swf
1/21/2007 9:47 PM 266485 biologi_filarisis.swf
1/21/2007 9:47 PM 490208 biologi_flu_burung.swf
5/16/2006 7:12 PM 133206 biologi_gametogenesis.swf
1/10/2011 5:01 PM 3192929 biologi_hereditas.swf
1/8/2011 11:17 AM 996376 biologi_jamur_fungi.swf
1/10/2011 9:29 AM 591901 biologi_jaringan.swf
1/10/2011 4:58 PM 329503 biologi_katabolisme_anabolisme.swf
1/8/2011 10:49 AM 860201 biologi_keaneka_ragaman_hayati.swf
1/8/2011 11:42 AM 872918 biologi_keseimbangan_lingkungan.swf
1/21/2007 9:47 PM 828576 biologi_lumut.swf
1/8/2011 10:52 AM 753827 biologi_mengenal_dunia_hewan.swf
1/8/2011 10:52 AM 651837 biologi_mengenal_dunia_tumbuhan.swf
1/8/2011 10:53 AM 630445 biologi_mengenal_ekosistem.swf
1/8/2011 10:48 AM 292583 biologi_mengenal_ilmu_biologi.swf
1/8/2011 10:54 AM 473242 biologi_mengenal_perubahan_ekosistem.swf
1/8/2011 10:51 AM 1158419 biologi_mengenal_protista.swf
1/10/2011 4:59 PM 222728 biologi_metabolisme_karbihidrat-protein.swf
1/21/2007 9:47 PM 309440 biologi_mitosi.swf
1/10/2011 5:00 PM 355807 biologi_mitosis_meiosis.swf
1/10/2011 5:02 PM 266858 biologi_mutasi.swf
1/21/2007 9:47 PM 154833 biologi_pembentukan_urine.swf
5/19/2006 6:07 PM 156842 biologi_pembuahan_ganda.swf
1/21/2007 9:47 PM 277086 biologi_penyakit_jantung_koroner.swf
1/21/2007 9:47 PM 109801 biologi_penyakit_sapi_gila.swf
6/24/2006 6:25 PM 1018341 biologi_pertumbuhan.swf
1/10/2011 4:57 PM 245707 biologi_pertumbuhan_perkembangan_tumbuhan.swf
1/10/2011 9:28 AM 489769 biologi_sel.swf
1/21/2007 9:47 PM 352697 biologi_sel_hewan.swf
1/21/2007 9:47 PM 213794 biologi_sel_tumbuhan.swf
5/20/2006 8:23 PM 426204 biologi_sintesa_protein.swf
1/10/2011 5:00 PM 227529 biologi_sintesa_protein_t.swf
1/10/2011 9:47 AM 2785711 biologi_sistem_ekresi_pada_manusia_dan_hewan.swf
1/10/2011 9:30 AM 507438 biologi_sistem_gerak.swf
1/10/2011 9:40 AM 2464964 biologi_sistem_gerak_pada_manusia_dan_hewan.swf
1/10/2011 9:51 AM 1475953 biologi_sistem_imun.swf
1/10/2011 9:48 AM 3012129 biologi_sistem_kordinasi_pada_manusia_dan_hewan.swf
1/10/2011 9:31 AM 361116 biologi_sistem_pecernaan.swf
1/10/2011 9:43 AM 3359868 biologi_sistem_pencernaan_2.swf
5/18/2006 8:53 PM 543554 biologi_sistem_pencernaan_manusia.swf
1/10/2011 9:30 AM 421348 biologi_sistem_peredaran_darah.swf
1/10/2011 9:44 AM 3142218 biologi_sistem_pernapasan.swf
1/10/2011 9:45 AM 2785711 biologi_sistem_pernapasan_pada_manusia_dan_hewan.swf
1/10/2011 9:49 AM 2444190 biologi_sistem_reproduksi_pada_manusia.swf
1/10/2011 9:42 AM 4490054 biologi_sistem_sirkulasi_darah_manusia_dan_hewan.swf
1/10/2011 9:37 AM 3470097 biologi_struktur_dan_fungsi_jaringan.swf
1/10/2011 9:39 AM 2950452 biologi_struktur_dan_fungsi_jaringan_hewan.swf
1/10/2011 9:36 AM 4211043 biologi_struktur_dan_fungsi_sel.swf
1/21/2007 9:47 PM 255584 biologi_terumbu_karang.swf
6/9/2006 4:00 PM 358126 biologi_virus.swf
1/8/2011 10:50 AM 1158677 biologi_virus_1.swf
1/8/2011 11:25 AM 800825 biologi_virus_kingdom_monera.swf
6/15/2010 12:46 PM 215680 blackbody-spectrum.swf
12/17/2010 10:49 AM 924998 buoyancy.swf
7/31/2010 3:44 AM 44723 calculus-grapher.swf
11/8/2010 12:34 PM 214605 charges-and-fields.swf
10/22/2010 5:20 AM 189765 collision-lab.swf
6/15/2010 12:45 PM 205564 curve-fitting.swf
12/17/2010 10:49 AM 911286 density.swf
1/11/2011 10:26 AM 973015 eko_akun_per_dagang.swf
1/11/2011 10:03 AM 910953 eko_apbn_apbd_kebijakan_fiskal.swf
1/11/2011 10:22 AM 1645830 eko_badan_usaha.swf
1/11/2011 10:07 AM 217403 eko_hukum_pelaksanaan_akuntansi.swf
1/11/2011 10:20 AM 1293661 eko_iktisaran_siklus_akun_per_dagang.swf
1/8/2011 11:56 AM 1073609 eko_kebijakan_ekonomi_pemerintah.swf
1/8/2011 12:27 PM 529403 eko_kebijakan_moneter.swf
1/11/2011 10:00 AM 284040 eko_ketenagakerjaan_penggangguran.swf
1/8/2011 11:57 AM 1014207 eko_konsumsi_investasi.swf
1/8/2011 12:25 PM 608076 eko_konsumsi_tabungan_investasi.swf
1/11/2011 10:24 AM 1791314 eko_koperasi_kewirausahaan.swf
1/11/2011 10:28 AM 673775 eko_mana_badan_usaha.swf
1/11/2011 10:21 AM 1516975 eko_manajemen.swf
1/8/2011 12:22 PM 1298965 eko_masalah_manusia.swf
1/8/2011 11:46 AM 1344392 eko_masalah_pokok_ekonomi.swf
1/11/2011 10:04 AM 329426 eko_pasar_uang_modal.swf
1/8/2011 11:56 AM 2360612 eko_pendapatan_nasional.swf
1/8/2011 12:24 PM 1225116 eko_pendapatan_nasional_inflasi.swf
1/11/2011 10:26 AM 322572 eko_penutupan_akun_per_dagang.swf
1/11/2011 10:21 AM 1370413 eko_penutupan_siklus_akun_per_dagang.swf
1/11/2011 10:05 AM 414745 eko_perdaganga_international_terbuka.swf
1/8/2011 12:30 PM 662574 eko_permasalahan_ekonomi.swf
1/8/2011 12:23 PM 1336342 eko_permintaan_penawaran.swf
1/11/2011 10:01 AM 9148085 eko_pertumbuhan_pengembangan.swf
1/8/2011 11:55 AM 4974728 eko_prilaku_harga_dan_pasar.swf
1/8/2011 11:47 AM 1737988 eko_prilaku_konsumen_produsen.swf
1/11/2011 10:19 AM 2034969 eko_siklus_akun_per_dagang.swf
1/11/2011 10:11 AM 2169138 eko_siklus_akun_per_jasa.swf
1/11/2011 10:06 AM 224163 eko_sistem_info_akuntansi.swf
1/11/2011 10:08 AM 258102 eko_struktur_dasar_akuntansi.swf
1/8/2011 12:00 PM 2672677 eko_uang_perbankan.swf
1/5/2011 5:38 PM 61705825 ekonomi__kelas1_hukumpermintaandanpenawaran.flv
1/5/2011 5:48 PM 54037979 ekonomi__kelas1_kegiatanpasarmodal.flv
1/5/2011 5:41 PM 68205151 ekonomi__kelas1_kelangkaansumberalam.flv
1/5/2011 5:44 PM 76634078 ekonomi__kelas1_metodeekonomi.flv
1/5/2011 5:51 PM 60551784 ekonomi__kelas1_pasarpersaingansempurna.flv
1/5/2011 5:53 PM 62260076 ekonomi__kelas1_perananpajakdalampembangunan.flv
1/5/2011 6:01 PM 79978828 ekonomi__kelas2_hargakeseimbangan.flv
1/5/2011 5:58 PM 62460732 ekonomi__kelas2_pengangguran.flv
1/6/2011 12:23 PM 65207117 ekonomi__kelas3_fungsipengorganisasiandlmpengelolaanbadanusaha.flv
1/6/2011 12:26 PM 75881593 ekonomi__kelas3_jenisjenisbumn.flv
1/6/2011 12:09 PM 74186636 ekonomi__kelas3_perdaganganinternasional.flv
1/6/2011 12:12 PM 78627510 ekonomi__kelas3_valutaasing.flv
1/21/2007 9:47 PM 36953 ekonomi_bungamajemuk.swf
9/12/2006 8:53 PM 377956 ekonomi_pajak.swf
6/6/2006 8:18 PM 977555 ekonomi_penawaran_permintaan.swf
5/18/2006 4:58 PM 174628 ekonomi_pendapatan_nasional.swf
6/9/2006 4:06 PM 397268 ekonomi_penyusunan_aktiva_tetap.swf
5/19/2006 6:11 PM 337132 ekonomi_perdagangan_international.swf
6/22/2006 2:45 PM 371548 ekonomi_siklus_ekonomi.swf
5/18/2006 4:55 PM 561200 ekonomi_uang_dan-inflasi.swf
6/15/2010 12:45 PM 195072 equation-grapher.swf
6/15/2010 12:42 PM 270408 estimation.swf
1/13/2010 2:52 AM 16643834 Expressing ability with CAN, COULD, BE ABLE TO.flv
6/15/2010 12:47 PM 217806 faradays-law.swf
1/13/2010 2:42 AM 18712091 Fear !.flv
1/8/2011 1:32 PM 7938504 fisika__energi_kerja.swf
1/8/2011 1:36 PM 8883157 fisika__fluida.swf
1/8/2011 5:13 PM 2329785 fisika__gelombang_bunyi.swf
1/8/2011 5:12 PM 818493 fisika__gelombang_cahaya.swf
1/8/2011 1:32 PM 5368507 fisika__gerak_osilasi.swf
1/8/2011 1:30 PM 7733550 fisika__gerak_planet.swf
1/8/2011 1:34 PM 7405238 fisika__gerak_rotasi_kesetimbangan.swf
1/8/2011 1:31 PM 4403217 fisika__hukum_hooke.swf
1/8/2011 5:15 PM 1248939 fisika__medanlistrik_potensial_kapasitor.swf
1/8/2011 1:33 PM 8609743 fisika__momentum_tumbukan.swf
1/8/2011 1:38 PM 5539711 fisika__teori_kinetik_gas.swf
1/8/2011 12:41 PM 1812980 fisika_alat2_optik.swf
1/21/2007 9:47 PM 81842 fisika_alat_ukur_listrik.swf
1/8/2011 1:29 PM 6640131 fisika_analisa_gerak_dengan_vektor.swf
1/10/2011 1:19 PM 1303215 fisika_atom.swf
1/8/2011 12:37 PM 1090175 fisika_besaran_satuan.swf
1/21/2007 9:47 PM 50766 fisika_efek_dopler.swf
1/8/2011 2:20 PM 817262 fisika_elastisitas_gerakan_harmonik.swf
6/9/2007 9:43 PM 103449 fisika_energi_kinetik.swf
6/9/2006 4:08 PM 248297 fisika_gaya.swf
1/8/2011 5:10 PM 1152121 fisika_gejala_gelombang.swf
1/8/2011 12:42 PM 825983 fisika_gelombang_elektromagnetik.swf
1/8/2011 12:37 PM 1162580 fisika_gerak_lurus.swf
1/8/2011 1:58 PM 2831545 fisika_gerak_rotasi_dan_kesetimbangan.swf
5/19/2006 6:18 PM 205517 fisika_glbb.swf
1/8/2011 2:19 PM 443565 fisika_grafitasi.swf
1/8/2011 12:41 PM 1396326 fisika_hukum_newton_tentang_gerak.swf
1/10/2011 1:22 PM 2850240 fisika_inti_atom.swf
1/10/2011 1:14 PM 2530968 fisika_kemagnetan.swf
6/27/2006 3:04 PM 215355 fisika_kesetimbangan benda tegar.swf
1/8/2011 2:18 PM 627175 fisika_kinematika_analisa_vektor.swf
1/21/2007 9:47 PM 144096 fisika_konfigurasi elektron.swf
5/30/2006 5:00 PM 169430 fisika_konfigurasi_elektron.swf
5/18/2006 7:55 PM 120387 fisika_listrik statis.swf
1/8/2011 12:43 PM 1013076 fisika_listrik.swf
1/8/2011 12:51 PM 844720 fisika_listrik_dinamis.swf
1/10/2011 1:12 PM 1701735 fisika_listrik_statis.swf
1/8/2011 12:40 PM 700295 fisika_melingkar_beraturan.swf
5/19/2006 7:43 PM 91693 fisika_momentum Linier.swf
5/19/2006 8:23 PM 448360 fisika_momentum sudut.swf
5/16/2006 5:54 PM 150763 fisika_pemuaian.swf
1/8/2011 12:47 PM 579035 fisika_pengukuran.swf
5/13/2006 9:04 PM 74619 fisika_perambatan Kalor.swf
5/16/2006 5:59 PM 146662 fisika_radiasi_benda_hitam.swf
1/10/2011 1:18 PM 824508 fisika_radiasi_benda_hitam_t.swf
1/21/2007 9:47 PM 97565 fisika_rangkaian_listrik.swf
1/10/2011 1:17 PM 1487227 fisika_rangkaian_listrik_tegangan_bolak_balik.swf
1/8/2011 12:44 PM 1348253 fisika_suhu_kalor.swf
1/21/2007 9:47 PM 67498 fisika_teori_kinetik_gas.swf
1/8/2011 2:22 PM 403077 fisika_teori_kinetik_gas_ideal.swf
1/10/2011 1:20 PM 1661841 fisika_teori_relativitas.swf
1/8/2011 2:24 PM 479756 fisika_termodinamika.swf
1/8/2011 2:24 PM 479756 fisika_termodinamika_t.swf
1/21/2007 9:47 PM 118314 fisika_teropong.swf
5/16/2006 5:05 PM 63208 fisika_transistor.swf
5/20/2006 3:54 PM 152420 fisika_tumbukan.swf
5/16/2006 6:14 PM 157198 fisika_uji_kompetensi_kelas_x_sem_1.swf
1/8/2011 2:20 PM 617936 fisika_usaha_dan_energi.swf
1/8/2011 1:52 PM 1663948 fisika_usaha_energi_daya.swf
1/21/2007 9:47 PM 43102 fisika_vektor.swf
1/10/2011 12:38 PM 877416 fisika_vektor_1.swf
6/15/2010 12:45 PM 185698 friction.swf
1/11/2011 10:53 AM 860287 geo_antrosfer.swf
1/11/2011 11:02 AM 977267 geo_antrosfer_2.swf
1/11/2011 10:43 AM 1239375 geo_atmosfer.swf
1/11/2011 11:01 AM 1804707 geo_biosfir.swf
1/11/2011 10:50 AM 1407706 geo_biosfir_sebaran_hewan.swf
1/11/2011 10:41 AM 1273050 geo_bumi_jagatraya.swf
1/11/2011 10:37 AM 1634796 geo_cuaca_iklim.swf
1/11/2011 10:37 AM 2747190 geo_dina_peru_batu_tanah.swf
1/11/2011 10:40 AM 1869503 geo_hidrosfir.swf
1/11/2011 10:54 AM 1346081 geo_kependudukan.swf
1/11/2011 12:37 PM 10890700 geo_keruangan_desa_kota.swf
1/11/2011 10:35 AM 1213937 geo_konsep_prins_pende_geo.swf
1/11/2011 12:38 PM 3507528 geo_konsep_wil_pusat_pertumbuhan.swf
1/11/2011 12:44 PM 140891 geo_konsep_wilayah_perwilayahan.swf
1/11/2011 10:58 AM 1153748 geo_lingkungan_hidup.swf
1/11/2011 10:42 AM 1945229 geo_litosfer_pedosfir.swf
1/11/2011 11:51 AM 9875719 geo_lokasi_industri_pertanian.swf
1/11/2011 11:42 AM 3092520 geo_membuat_peta.swf
1/11/2011 11:40 AM 10988973 geo_pengetahuan_peta.swf
1/11/2011 11:52 AM 5369103 geo_pengindraan_jauh.swf
1/11/2011 12:35 PM 8081676 geo_sisfo_geografi_sig.swf
1/11/2011 12:44 PM 799759 geo_sistem_info_geografis.swf
1/11/2011 10:55 AM 1322198 geo_sumber_daya_alam.swf
1/11/2011 10:36 AM 772811 geo_tatasurya_bumi.swf
1/11/2011 12:43 PM 1087989 geo_teknik_dasar_pemetaan.swf
1/11/2011 12:40 PM 8314530 geo_wil_negara_maju_berkembang.swf
5/18/2006 5:01 PM 552838 geografi_citra_pengindaraan_jauh.swf
7/6/2006 3:14 PM 706478 geografi_dinamika_perubahan_hidrosfir.swf
5/17/2006 2:53 PM 271038 geografi_el_nino.swf
5/18/2006 7:50 PM 380567 geografi_gis.swf
5/19/2006 6:15 PM 530101 geografi_perubahan_atmosfir.swf
1/5/2011 5:26 PM 58529998 geografi_sma1_daerahaliransungai.flv
1/5/2011 5:29 PM 61283087 geografi_sma1_hasildarierupsi.flv
1/5/2011 4:46 PM 60590042 geografi_sma1_jenis-jenisBUMN.flv
1/5/2011 5:24 PM 62298334 geografi_sma1_mengamatiawan.flv
1/5/2011 4:37 PM 66977044 geografi_sma1_pencemaran_tanah.flv
1/5/2011 5:06 PM 60881264 geografi_sma3_air_tanah.flv
1/5/2011 5:08 PM 52812713 geografi_sma3_danau&manfaatnya.flv
1/5/2011 4:52 PM 63307771 geografi_sma3_dimanabintangitu.flv
1/5/2011 4:56 PM 71204290 geografi_sma3_galaksi.flv
1/5/2011 5:11 PM 71548967 geografi_sma3_perjalananairdibumi.flv
1/5/2011 5:00 PM 74675953 geografi_sma3_planetkita.flv
1/5/2011 5:02 PM 68597716 geografi_sma3_seharisemalam.flv
7/15/2006 3:51 PM 829020 geografi_tsunami.swf
6/15/2010 12:42 PM 371213 geometric-optics.swf
1/6/2010 1:09 PM 10857525 Giving News.flv
1/6/2010 1:06 PM 16275176 GoodBad.flv
12/23/2009 5:58 PM 18560709 HelloGoodbye.flv
6/9/2006 4:12 PM 593531 ips_perubahan_sosial_budaya.swf
1/4/2011 12:10 PM 4587512 Kesenian_seni rupa.swf
1/11/2011 2:24 PM 286620 kim_alkana_alkena.swf
1/11/2011 2:23 PM 151718 kim_atom_carbon.swf
1/11/2011 8:39 PM 739962 kim_benzena_makromolekul.swf
1/11/2011 2:21 PM 230368 kim_hukum_dasar.swf
1/11/2011 2:19 PM 422355 kim_ikatan_kimia.swf
1/11/2011 2:47 PM 1024192 kim_kesetimbangan_ion.swf
1/11/2011 2:35 PM 1419328 kim_kesetimbangan_kimia.swf
1/11/2011 2:36 PM 1160090 kim_kesetimbangan_larutan.swf
1/11/2011 2:37 PM 400450 kim_koloid.swf
1/11/2011 2:27 PM 236003 kim_komposisi_senyawa_carbon.swf
1/11/2011 2:34 PM 291752 kim_laju_reaksi.swf
1/11/2011 2:35 PM 1055265 kim_larutan_asam_basa.swf
1/11/2011 2:22 PM 182866 kim_larutan_el_noelektro.swf
1/11/2011 2:25 PM 266177 kim_minyak_bumi.swf
1/11/2011 2:22 PM 365245 kim_perhitungan_kimia.swf
1/11/2011 8:36 PM 768571 kim_rea_red_elek_elektrolisis.swf
1/11/2011 2:23 PM 188302 kim_reaksi_redok.swf
1/11/2011 8:37 PM 695977 kim_senyawa_karbon.swf
1/11/2011 8:35 PM 886590 kim_sifat_kol_larutan.swf
1/11/2011 2:33 PM 552590 kim_stru_atom_perio_ikatan_kimia.swf
1/11/2011 2:41 PM 1502585 kim_struktur_atom.swf
1/11/2011 2:19 PM 521545 kim_tabel_periodik.swf
1/11/2011 2:20 PM 257711 kim_tatanama_senyawa.swf
1/11/2011 2:34 PM 321087 kim_termo_kimia.swf
1/11/2011 2:45 PM 784291 kim_termokimia.swf
1/11/2011 8:37 PM 789908 kim_unsur.swf
6/10/2006 7:36 PM 395113 kimia_alkali_alkali_tanah.swf
7/19/2006 7:16 PM 330282 kimia_asam_basa-ph_larutan.swf
1/21/2007 9:47 PM 233441 kimia_elektrokimia.swf
7/21/2006 6:33 PM 484488 kimia_halogen.swf
1/21/2007 9:47 PM 45104 kimia_hidrolisi.swf
5/16/2006 7:35 PM 65630 kimia_hidrolisis_garam_dalam_air.swf
1/21/2007 9:47 PM 128613 kimia_hukum_gaylusac_avogadro.swf
1/21/2007 9:47 PM 70929 kimia_hukum_hess.swf
7/20/2006 6:56 PM 294860 kimia_ikatan_kovalen.swf
1/21/2007 9:47 PM 85961 kimia_kegagalan_aturan_outet.swf
7/20/2006 6:51 PM 165338 kimia_kelarutan.swf
1/21/2007 9:47 PM 104456 kimia_kesetimbangan_kimia.swf
1/21/2007 9:47 PM 92175 kimia_kesetimbangan_larutan.swf
1/21/2007 9:47 PM 128719 kimia_laju_reaksi.swf
1/21/2007 9:47 PM 106526 kimia_larutan_buffer.swf
1/21/2007 9:47 PM 169467 kimia_larutan_elektrolisi.swf
1/21/2007 9:47 PM 35301 kimia_penyetaraan_reaksi_redok.swf
1/21/2007 9:47 PM 189169 kimia_polimer.swf
5/16/2006 7:25 PM 553992 kimia_senayawa_karbon.swf
1/21/2007 9:47 PM 49747 kimia_senyawa_komplek.swf
5/16/2006 7:45 PM 99993 kimia_sifat_kalogatif_larutan.swf
5/16/2006 7:53 PM 123226 kimia_sistem_koloid.swf
1/21/2007 9:47 PM 357967 kimia_stoikiometri.swf
5/16/2006 6:11 PM 60667 kimia_teori_atom.swf
6/1/2006 4:31 PM 306987 kimia_unsur_transisi_periode_empat.swf
6/15/2010 12:47 PM 317471 lunar-lander.swf
6/15/2010 12:44 PM 298837 mass-spring-lab.swf
1/11/2011 8:11 PM 946642 mat_akar_pangkat_log.swf
1/11/2011 8:10 PM 372770 mat_bilangan_reel.swf
1/11/2011 3:07 PM 702787 mat_deret.swf
1/11/2011 3:14 PM 684720 mat_fung_pers_eks_log.swf
1/11/2011 8:18 PM 960584 mat_fungsi.swf
1/11/2011 3:05 PM 810979 mat_integral.swf
1/11/2011 2:55 PM 677859 mat_komposisi_invers_fungsi.swf
1/11/2011 2:56 PM 554387 mat_limit_fungsi.swf
1/11/2011 8:17 PM 3672872 mat_logika.swf
1/11/2011 3:06 PM 722827 mat_matrik.swf
1/11/2011 2:53 PM 806520 mat_peluang.swf
1/11/2011 3:02 PM 1281822 mat_peluang_2.swf
1/11/2011 8:12 PM 660314 mat_per_pertidaksamaan.swf
1/11/2011 3:05 PM 521518 mat_program_linier.swf
1/11/2011 8:21 PM 1433573 mat_ruang_dimensi_dua.swf
1/11/2011 2:52 PM 1268521 mat_statistika.swf
1/11/2011 3:08 PM 793893 mat_transformasi_geometri.swf
1/11/2011 2:57 PM 818869 mat_turunan.swf
1/11/2011 3:07 PM 776448 mat_vektor.swf
1/21/2007 9:47 PM 289639 matematika_aplikasi_fungsi_sin_cos.swf
5/16/2006 4:44 PM 158002 matematika_barisan_deret.swf
1/21/2007 9:47 PM 76903 matematika_fungsi_kuadrat.swf
5/17/2006 5:36 PM 119173 matematika_fungsi_persamaan_eksponen.swf
1/21/2007 9:47 PM 171197 matematika_kedudukan_titik_thd_garis_bidang.swf
7/6/2006 3:04 PM 111081 matematika_komposisi_transformasi.swf
5/18/2006 8:19 PM 86446 matematika_logika_matematika.swf
1/21/2007 9:47 PM 60016 matematika_matrik.swf
1/21/2007 9:47 PM 96342 matematika_menggambar_bangun_ruang.swf
1/21/2007 9:47 PM 86659 matematika_peluang.swf
1/21/2007 9:47 PM 87540 matematika_peluang_kaidah_perkalian.swf
1/21/2007 9:47 PM 139362 matematika_persamaan_garis_singgung_lingkaran.swf
1/21/2007 9:47 PM 54194 matematika_persamaan_lier_dua_peubah.swf
1/21/2007 9:47 PM 160243 matematika_tabel_ogive_median.swf
1/21/2007 9:47 PM 186118 matematika_tiik_bidang.swf
7/6/2006 2:59 PM 137907 matematika_transformasi_geometri.swf
1/21/2007 9:47 PM 47318 matematika_trigonometri.swf
1/21/2007 9:47 PM 44345 matematika_vektor.swf
6/15/2010 12:45 PM 279968 my-solar-system.swf
6/15/2010 12:43 PM 218323 ohms-law.swf
6/15/2010 12:43 PM 250841 pendulum-lab.swf
12/23/2009 6:03 PM 17726101 Please & Thank You.flv
6/15/2010 12:45 PM 218505 plinko-probability.swf
11/28/2010 3:29 PM 23612733 presen tense (2).flv
11/28/2010 3:29 PM 23612733 presen tense.flv
6/15/2010 12:46 PM 348795 projectile-motion.swf
4/17/2010 3:08 AM 20539064 Questions & Answers (2).flv
4/17/2010 3:08 AM 20539064 Questions & Answers.flv
6/15/2010 12:45 PM 215056 resistance-in-a-wire.swf
12/23/2009 6:02 PM 14512179 Response to 'Please''Thank You'.flv
1/6/2010 1:11 PM 17987059 Saying Sorry.flv
1/12/2011 10:12 AM 1016636 sej_hub_iptek_pd2.swf
1/12/2011 10:13 AM 596798 sej_iptek_indon.swf
1/11/2011 8:48 PM 1556085 sej_kehidupan_awal_purba.swf
1/12/2011 10:00 AM 1311138 sej_kerajaan_hindu_budha.swf
1/12/2011 10:10 AM 711441 sej_masa_revformasi.swf
1/11/2011 8:49 PM 514112 sej_metode_penelitian.swf
1/12/2011 10:10 AM 788891 sej_orde_baru.swf
1/12/2011 10:05 AM 660894 sej_pendudukan_jepang.swf
1/12/2011 10:07 AM 975819 sej_peng_rev_dunia.swf
1/12/2011 9:59 AM 739641 sej_per_hindu_budha.swf
1/11/2011 8:53 PM 1477529 sej_per_kuno_eropa.swf
1/12/2011 10:04 AM 842263 sej_pergerakan_kebangsaan.swf
1/12/2011 10:00 AM 1103462 sej_perkemb_islam.swf
1/12/2011 10:03 AM 811051 sej_perkemb_masa_kolonial.swf
1/11/2011 8:43 PM 297539 sej_ruanglingkup.swf
1/11/2011 8:52 PM 897754 sej_sebaran_man_ind.swf
1/11/2011 8:45 PM 3104866 sej_sebelum_sesudah_aksara.swf
1/7/2011 2:44 PM 86520064 sejarah_melestarikanBudayaBangsa.flv
1/7/2011 2:37 PM 91044972 sejarah_ngaben.flv
1/12/2011 5:47 AM 2648550 sos-sosiologi_sebagai_ilmu.swf
1/12/2011 6:02 AM 558698 sos_dampak_perubahan_sosial.swf
1/12/2011 6:14 AM 1891906 sos_fenomena_kehidupan.swf
1/12/2011 5:49 AM 1691447 sos_interraksi_dinamika_sosial.swf
1/12/2011 6:16 AM 854495 sos_kajian_masyarakat.swf
1/12/2011 5:57 AM 625868 sos_kelompok_sosial.swf
1/12/2011 6:17 AM 1024629 sos_keteraturan_sosial.swf
1/12/2011 5:56 AM 417026 sos_konflik_sosial.swf
1/12/2011 6:12 AM 477567 sos_laporan_pene_sosial.swf
1/12/2011 6:03 AM 441774 sos_lembaga_sosial.swf
1/12/2011 5:56 AM 518455 sos_mobilitas_sosial.swf
1/12/2011 5:48 AM 922203 sos_nilai_norma_sosial.swf
1/12/2011 6:06 AM 886089 sos_penelitian_sosial.swf
1/12/2011 5:52 AM 1908881 sos_pengendalian_sosial.swf
1/12/2011 6:11 AM 825917 sos_pengolahan_data_pene_sosial.swf
1/12/2011 6:01 AM 780001 sos_perubahan_sosial.swf
1/12/2011 6:08 AM 2430791 sos_perubahan_sosial_2.swf
1/12/2011 5:51 AM 1759380 sos_prilaku_menyimpang.swf
1/12/2011 6:18 AM 919461 sos_proses_sosial_pem_pribadi.swf
1/12/2011 6:09 AM 937977 sos_ranc_met_pene_sosial.swf
1/12/2011 5:50 AM 923995 sos_sosialisasi_pemb_kepri.swf
1/12/2011 5:55 AM 642089 sos_staratafikasi_sosial.swf
1/12/2011 6:00 AM 702760 sos_struktur_sosial.swf
7/20/2006 8:09 PM 507564 sosiologi_iteraksisosial.swf
7/20/2006 7:35 PM 633534 sosiologi_mobilitas_sosial.swf
5/18/2006 4:48 PM 427451 sosiologi_pelangi_nusantara.swf
7/20/2006 7:39 PM 858982 sosiologi_perilaku_menyimpang.swf
5/17/2006 3:04 PM 361283 sosiologi_strata_sosial.swf
6/15/2010 12:46 PM 334084 stern-gerlach.swf
1/13/2010 2:44 AM 18225551 Technology .flv
1/6/2010 1:12 PM 16124429 The way you feel.flv
1/11/2011 1:05 PM 2374824 tik_akses_internet.swf
1/11/2011 1:51 PM 3901575 tik_berkreasi_dengan_inkscape.swf
1/11/2011 1:55 PM 2508145 tik_berkreasi_gimp.swf
1/11/2011 1:13 PM 4523698 tik_calc_open_office.swf
1/11/2011 1:17 PM 3772040 tik_cetak_calc.swf
1/11/2011 1:00 PM 3025208 tik_cetak_dokumen.swf
1/11/2011 1:15 PM 2345411 tik_database_calc.swf
1/11/2011 12:53 PM 3427207 tik_dokumen_open_office.swf
1/11/2011 1:07 PM 4178482 tik_e_mail.swf
1/11/2011 1:54 PM 4148347 tik_efek_gmabar_gimp.swf
1/11/2011 1:48 PM 1287516 tik_gambar_digital.swf
1/11/2011 1:16 PM 2627377 tik_grafik_calc.swf
1/11/2011 1:04 PM 3267281 tik_hardware_untuk_internet.swf
1/11/2011 12:55 PM 5571222 tik_insert_tabel_gambar_open_office.swf
1/11/2011 1:10 PM 6305033 tik_jaringan_sosial_di_internet.swf
1/11/2011 1:14 PM 4475466 tik_lembar_kerja_calc.swf
1/11/2011 12:56 PM 5058182 tik_mail_merge_open_office.swf
1/11/2011 1:50 PM 4113776 tik_membuat_menu_icon_inkscape.swf
1/11/2011 1:53 PM 3905875 tik_membuat_objek_dasar_gimp.swf
1/11/2011 1:49 PM 1726586 tik_mengenal_inkscape.swf
1/11/2011 1:59 PM 2670086 tik_mengenal_openoff_impress.swf
1/11/2011 1:06 PM 4817212 tik_mengenal_www.swf
1/11/2011 12:51 PM 4093296 tik_menggunakan_open_office.swf
1/11/2011 1:52 PM 2305417 tik_menu_icon_gimp.swf
1/11/2011 12:49 PM 5623626 tik_open_office.swf
1/11/2011 2:00 PM 5445791 tik_presentasi_impress.swf
1/11/2011 1:14 PM 2651697 tik_rumus_fungsi_calc.swf
1/11/2011 1:03 PM 2368997 tik_sejarah_internet.swf
3/5/2018 3:45 PM <dir> tryout-2016
5/16/2006 7:55 PM 45379 uji_kompetensi.swf
5/16/2006 8:04 PM 82371 uji_kompetensi_b_ingris_kelas_x_se_2.swf
5/16/2006 7:14 PM 166752 uji_kompetensi_biologi.swf
5/16/2006 4:28 PM 88204 uji_kompetensi_matematika_kelas_xi.swf
6/15/2010 12:42 PM 236488 vector-addition.swf
6/15/2010 12:44 PM 268306 wave-on-a-string.swf